PDB entry 4bmb

View 4bmb on RCSB PDB site
Description: Crystal structure of the N terminal domain of human Galectin 8
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate recognition
Deposited on 2013-05-07, released 2014-03-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.1595
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-8
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00214 (0-149)
  Domains in SCOPe 2.05: d4bmba_
• Heterogens: ZN, LAT, NA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bmbA (A:)
  slnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradva
  fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
  llyghrigpekidtlgiygkvnihsigfsf