PDB entry 4bma

View 4bma on RCSB PDB site
Description: structural of Aspergillus fumigatus UDP-N-acetylglucosamine pyrophosphorylase
Class: transferase
Keywords: transferase, udp-glcnac biosynthesis pathway
Deposited on 2013-05-07, released 2013-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.21455
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bmaa_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bmab_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bmaA (A:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmaA (A:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppp
    asleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcf
    diglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfg
    lnksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgie
    hihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveys
    eidketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcikpn
    gikleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwi
    ekaggivitegdvvgvevsplisyggegleflkgreikapafiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bmaB (B:)
    mavaiketvsnfmerfhghpenlprepsaeefqqlrkkytdagqghvfafvdelqtgers
    qlfhqlssfdpvrineladkalnppkaddgpasleplpdiatasildsdpkdleqwyeeg
    lklvagnkvavvlmaggqgtrlgssapkgcfdiglpshkslfqiqaeriaklqllaqris
    gkeavipwyvmtsgptrkpteeffeqhkyfglnksdviifeqgvlpcisnegkilmeskf
    kvavapdgnggiyqalltsgvredmrkrgiehihtycvdnclvkvadpvfigfaaskqvd
    iatkvvrkrnatesvglilqkngkpdvveyseidketaeakdpkqpdvlkfraanivnhy
    ysfkffesielwahklphhvarkkipcikegtgeffkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmaB (B:)
    psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppa
    sleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcfd
    iglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfgl
    nksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgieh
    ihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveyra
    anivnhyysfkffesielwahklphhvarkkipcifkpekpngikleqfvfdvfpmtple
    kfacievrredefsplknargtgeddpdtskrdimsqgqrwiekaggivitegdvvgvev
    splisyggegleflkgreikapafiek