PDB entry 4blt

View 4blt on RCSB PDB site
Description: P4 PROTEIN FROM BACTERIOPHAGE PHI12 S292A MUTANT IN COMPLEX WITH AMPcPP
Class: hydrolase
Keywords: hydrolase, cystoviridae
Deposited on 2013-05-04, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.26402
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d4blta_
  • Chain 'B':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d4bltb_
  • Chain 'C':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d4bltc_
  • Heterogens: APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bltA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bltA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeas
    rsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtqtvikndelesv
    lrrlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bltB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bltB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtqtvikndelesvl
    rrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bltC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bltC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptdkivelvkeasrsns
    tslvistdvdgewqvltrtgeglqrlthtlqtsygehavltihtqtvikndelesvlrrl