PDB entry 4bls

View 4bls on RCSB PDB site
Description: P4 PROTEIN FROM BACTERIOPHAGE PHI12 Q278A MUTANT IN COMPLEX WITH AMPcPP
Class: hydrolase
Keywords: hydrolase, packaging, cystoviridae
Deposited on 2013-05-04, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.25746
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (277)
    Domains in SCOPe 2.07: d4blsa_
  • Chain 'B':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (277)
    Domains in SCOPe 2.07: d4blsb_
  • Chain 'C':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (277)
    Domains in SCOPe 2.07: d4blsc_
  • Heterogens: APC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4blsA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4blsA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsqtvikndelesv
    lr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4blsB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4blsB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    snstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsqtvikndelesv
    lrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4blsC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasrsnstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4blsC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnpsnddkivelvkeasrs
    nstslvistdvdgewqvltrtgeglarlthtlqtsygehsvltihtsqtvikndelesvl
    rr