PDB entry 4blc

View 4blc on RCSB PDB site
Description: the structure of orthorhombic crystals of beef liver catalase
Deposited on 1998-09-27, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d4blca_
  • Chain 'B':
    Domains in SCOP 1.55: d4blcb_
  • Chain 'C':
    Domains in SCOP 1.55: d4blcc_
  • Chain 'D':
    Domains in SCOP 1.55: d4blcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4blcA (A:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4blcB (B:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4blcC (C:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4blcD (D:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne