SCOPe 2.05: Structural Classification of Proteins

PDB entry 4bl5

View 4bl5 on RCSB PDB site
Description: Crystal structure of human GDP-L-fucose synthase with bound NADP and product GDP-L-fucose
Class: oxidoreductase
Keywords: oxidoreductase, isomerase
Deposited on 2013-05-01, released 2014-05-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22482
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
  - expression tag (21)
Domains in SCOPe 2.05: d4bl5a_
Chain 'B':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-335)
  - expression tag (16-21)
Domains in SCOPe 2.05: d4bl5b_
Chain 'C':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-335)
  - expression tag (15-21)
Domains in SCOPe 2.05: d4bl5c_
Chain 'D':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-335)
  - expression tag (21)
Domains in SCOPe 2.05: d4bl5d_
Chain 'E':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
  - expression tag (15-21)
Domains in SCOPe 2.05: d4bl5e_
Chain 'F':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
Domains in SCOPe 2.05: d4bl5f_
Chain 'G':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
  - expression tag (15-21)
Domains in SCOPe 2.05: d4bl5g_
Chain 'H':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-335)
  - expression tag (21)
Domains in SCOPe 2.05: d4bl5h_
Chain 'I':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-335)
  - expression tag (15-21)
Domains in SCOPe 2.05: d4bl5i_
Chain 'J':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
Domains in SCOPe 2.05: d4bl5j_
Chain 'K':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
Domains in SCOPe 2.05: d4bl5k_
Chain 'L':
Compound: GDP-l-fucose synthase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q13630 (22-End)
  - expression tag (15-21)
Domains in SCOPe 2.05: d4bl5l_
Heterogens: NAP, GFB, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4bl5A (A:)
mhhhhhhssgvdlgtenlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskd
adltdtaqtralfekvqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevg
arkvvsclstcifpdkttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctf
taviptnvfgphdnfniedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaq
lfiwvlreynevepiilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktas
nsklrtylpdfrftpfkqavketcawftdnyeqark