PDB entry 4bku

View 4bku on RCSB PDB site
Description: Enoyl-ACP reductase FabI from Burkholderia pseudomallei with cofactor NADH and inhibitor PT155
Class: oxidoreductase
Keywords: oxidoreductase, fatty acid biosynthesis, enoyl- acp reductase, pyridone
Deposited on 2013-04-29, released 2014-04-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.1383
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:884204]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4bkua_
  • Heterogens: NAI, 1S5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bkuA (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bkuA (A:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvggm