PDB entry 4bkm

View 4bkm on RCSB PDB site
Description: Crystal structure of the murine AUM (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase)
Class: hydrolase
Keywords: had family, hydrolase
Deposited on 2013-04-26, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bkma_
  • Chain 'B':
    Compound: pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bkmb_
  • Chain 'C':
    Compound: pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bkmc_
  • Chain 'D':
    Compound: pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bkmd_
  • Heterogens: MG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bkmA (A:)
    gamgmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlf
    vsnnsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspal
    aaeleavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylq
    qpdcllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfs
    vdpartlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesi
    adlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bkmA (A:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
    leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
    cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
    artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
    megl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bkmB (B:)
    gamgmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlf
    vsnnsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspal
    aaeleavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylq
    qpdcllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfs
    vdpartlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesi
    adlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bkmB (B:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
    leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
    cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
    artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
    megl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bkmC (C:)
    gamgmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlf
    vsnnsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspal
    aaeleavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylq
    qpdcllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfs
    vdpartlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesi
    adlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bkmC (C:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
    leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
    cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
    artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
    megl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bkmD (D:)
    gamgmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlf
    vsnnsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspal
    aaeleavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylq
    qpdcllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfs
    vdpartlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesi
    adlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bkmD (D:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
    leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
    cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
    artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
    megl