PDB entry 4bkd

View 4bkd on RCSB PDB site
Description: Crystal Structure of an unusually linked dimeric variant of Bet v 1 (b)
Class: allergen
Keywords: allergen, dimerisation, polysulfide
Deposited on 2013-04-23, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.17842
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (4)
    Domains in SCOPe 2.06: d4bkda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bkdA (A:)
    gvfnxetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn