PDB entry 4bk9

View 4bk9 on RCSB PDB site
Description: Crystal structure of 2-keto-3-deoxy-6-phospho-gluconate aldonase from Zymomonas mobilis ATCC 29191
Class: lyase
Keywords: lyase, entner-doudoroff-pathway, chemoselectivity, pyruvate specificity
Deposited on 2013-04-22, released 2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.13729
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxo glutarate aldolase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bk9a_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxo glutarate aldolase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bk9b_
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxo glutarate aldolase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bk9c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bk9A (A:)
    mhhhhhhmirdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcalea
    ikimkevpgavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvan
    aadvmlgldlgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenps
    ilcvggswvvpagkpdvakitalakeasafkraava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bk9A (A:)
    rdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevpg
    avvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgld
    lgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenpsilcvggswv
    vpagkpdvakitalakeasafkraava
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bk9B (B:)
    mhhhhhhmirdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcalea
    ikimkevpgavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvan
    aadvmlgldlgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenps
    ilcvggswvvpagkpdvakitalakeasafkraava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bk9B (B:)
    rdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevpg
    avvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgld
    lgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenpsilcvggswv
    vpagkpdvakitalakeasafkraava
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bk9C (C:)
    mhhhhhhmirdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcalea
    ikimkevpgavvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvan
    aadvmlgldlgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenps
    ilcvggswvvpagkpdvakitalakeasafkraava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bk9C (C:)
    rdidsvmrlapvmpvlviediadakpiaealvagglnvlevtlrtpcaleaikimkevpg
    avvgagtvlnakmldqaqeagceffvspgltadlgkhavaqkaallpgvanaadvmlgld
    lgldrfkffpaenigglpalksmasvfrqvrfcptggitpasapkylenpsilcvggswv
    vpagkpdvakitalakeasafkraav