PDB entry 4bj8

View 4bj8 on RCSB PDB site
Description: Zebavidin
Class: biotin-binding protein
Keywords: biotin-binding protein
Deposited on 2013-04-17, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19546
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8a_
  • Chain 'B':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8b_
  • Chain 'C':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8c_
  • Chain 'D':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8d_
  • Chain 'E':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8e_
  • Chain 'F':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8f_
  • Chain 'G':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8g_
  • Chain 'H':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8h_
  • Chain 'I':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8i_
  • Chain 'J':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8j_
  • Chain 'K':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650 (2-End)
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8k_
  • Chain 'L':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8l_
  • Chain 'M':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8m_
  • Chain 'N':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8n_
  • Chain 'O':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650 (2-End)
      • expression tag (0-1)
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8o1, d4bj8o2
  • Chain 'P':
    Compound: zebavidin
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7F650
      • conflict (40)
    Domains in SCOPe 2.07: d4bj8p_
  • Heterogens: BTN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bj8A (A:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8A (A:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bj8B (B:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8B (B:)
    scnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqptv
    sfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bj8C (C:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8C (C:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bj8D (D:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8D (D:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bj8E (E:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8E (E:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bj8F (F:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8F (F:)
    scnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqptv
    sfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4bj8G (G:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8G (G:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4bj8H (H:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8H (H:)
    scnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqptv
    sfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4bj8I (I:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8I (I:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4bj8J (J:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8J (J:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4bj8K (K:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8K (K:)
    vsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqp
    tvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4bj8L (L:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8L (L:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffktg
    v
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4bj8M (M:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8M (M:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffktg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4bj8N (N:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8N (N:)
    scnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqptv
    sfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4bj8O (O:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8O (O:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    kt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4bj8P (P:)
    qtvsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgt
    qptvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediff
    ktgvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj8P (P:)
    sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt
    vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffktg