PDB entry 4bj3

View 4bj3 on RCSB PDB site
Description: Integrin alpha2 I domain E318W-collagen complex
Class: cell adhesion
Keywords: cell adhesion
Deposited on 2013-04-16, released 2013-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17301
      • engineered mutation (197)
    Domains in SCOPe 2.06: d4bj3a_
  • Chain 'B':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17301
      • engineered mutation (197)
    Domains in SCOPe 2.06: d4bj3b_
  • Chain 'C':
    Compound: gfoger peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BJ3 (0-End)
  • Chain 'D':
    Compound: gfoger peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BJ3 (0-End)
  • Chain 'E':
    Compound: gfoger peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BJ3 (0-End)
  • Heterogens: MG, CL, BTB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bj3A (A:)
    mnhhhhhhhhhhtslykkagfslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdwaallekagtlgeqifsiegtvefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj3A (A:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdwaall
    eka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bj3B (B:)
    mnhhhhhhhhhhtslykkagfslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdwaallekagtlgeqifsiegtvefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bj3B (B:)
    idvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktk
    eemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsml
    kavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdwaallf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.