PDB entry 4bif

View 4bif on RCSB PDB site
Description: Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria
Class: lyase
Keywords: lyase, metal-dependent, mandelonitrile, site-directed mutagenesis
Deposited on 2013-04-10, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.1767
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifa_
  • Chain 'B':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifb_
  • Chain 'C':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifc_
  • Chain 'D':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifd_
  • Chain 'E':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bife_
  • Chain 'F':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4biff_
  • Chain 'G':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifg_
  • Chain 'H':
    Compound: Cupin 2 conserved barrel domain protein
    Species: GRANULICELLA TUNDRICOLA [TaxId:1198114]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bifh_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bifA (A:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifA (A:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bifB (B:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifB (B:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bifC (C:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifC (C:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bifD (D:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifD (D:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bifE (E:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifE (E:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bifF (F:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifF (F:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4bifG (G:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifG (G:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4bifH (H:)
    msyyhhhhhhdydipttenlyfqgameikrvgsqasgkgpadwftgtvridplfqapdpa
    lvagasvtfepgartawhthplgqtlivtagcgwaqreggaveeihpgdvvwfspgekhw
    hgaapttamthlaiqerldgkavdwmehvtdeqyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bifH (H:)
    meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
    livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
    mehvtdeqyrr