PDB entry 4bht

View 4bht on RCSB PDB site
Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-04-06, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1626
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhta1, d4bhta2
  • Chain 'B':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhtb1, d4bhtb2
  • Chain 'C':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhtc1, d4bhtc2
  • Chain 'D':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhtd1, d4bhtd2
  • Chain 'E':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhte1, d4bhte2
  • Chain 'F':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bhtf1, d4bhtf2
  • Heterogens: GOL, EPE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bhtA (A:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtA (A:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bhtB (B:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtB (B:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bhtC (C:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtC (C:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bhtD (D:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtD (D:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvlpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfap
    gkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqg
    aniagfvkvadamlaqgvi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bhtE (E:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtE (E:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bhtF (F:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhtF (F:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi