PDB entry 4bhl

View 4bhl on RCSB PDB site
Description: Crystal structure of Litopenaeus vannamei arginine kinase in binary complex with arginine
Class: transferase
Keywords: transferase, binary complex, phosphagen
Deposited on 2013-04-03, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1748
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Litopenaeus vannamei [TaxId:6689]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q004B5 (0-355)
      • conflict (130)
      • conflict (293)
      • conflict (342)
    Domains in SCOPe 2.06: d4bhla1, d4bhla2
  • Heterogens: ARG, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bhlA (A:)
    madaaviekleagfkkleaatdcksllkkyltkevfdklkdkrtslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpcltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanacrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiklpklaaneekleev
    agkynlqvrgtrgehteaeggiydisnkrrmgltefqavkemedgilelikiekem
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bhlA (A:)
    madaaviekleagfkkleaatdcksllkkyltkevfdklkdkrtslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpcltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanacrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiklpklaaneekleev
    agkynlqvrgtggiydisnkrrmgltefqavkemedgilelikiekem