PDB entry 4bh6

View 4bh6 on RCSB PDB site
Description: Insights into degron recognition by APC coactivators from the structure of an Acm1-Cdh1 complex
Class: cell cycle
Keywords: anaphase promoting complex, acm1, cell cycle, ubiquitination, d box
Deposited on 2013-03-29, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22075
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6a_
  • Chain 'B':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6b_
  • Chain 'C':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6c_
  • Chain 'D':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6d_
  • Chain 'E':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6e_
  • Chain 'F':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6f_
  • Chain 'G':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6g_
  • Chain 'H':
    Compound: apc/c activator protein cdh1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bh6h_
  • Chain 'I':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: apc/c-cdh1 modulator 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bh6A (A:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6A (A:)
    rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
    ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
    rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
    ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
    elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
    fdkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bh6B (B:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6B (B:)
    rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
    ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
    rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
    ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
    elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
    fdkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bh6C (C:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6C (C:)
    rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
    ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
    rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
    ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
    elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
    fdkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bh6D (D:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6D (D:)
    frqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdten
    eytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrd
    hrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltf
    dehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwsknt
    nelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywk
    lfdkp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bh6E (E:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6E (E:)
    qiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdteney
    tslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdhr
    ilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfde
    hkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntne
    lvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywklf
    dkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bh6F (F:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6F (F:)
    rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
    ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
    rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
    ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
    elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
    fdkp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4bh6G (G:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6G (G:)
    rqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdtene
    ytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdh
    rilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfd
    ehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntn
    elvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywkl
    fdk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4bh6H (H:)
    gkqfrqiakvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcd
    teneytslswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsg
    srdhrilhrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspi
    ltfdehkaavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvws
    kntnelvtshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlr
    ywklfdkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh6H (H:)
    akvpyrvldapsladdfyyslidwsstdvlavalgksifltdnntgdvvhlcdteneyts
    lswigagshlavgqanglveiydvmkrkcirtlsghidrvaclswnnhvltsgsrdhril
    hrdvrmpdpffetieshtqevcglkwnvadnklasggndnvvhvyegtskspiltfdehk
    aavkamawsphkrgvlatgggtadrrlkiwnvntsikmsdidsgsqicnmvwskntnelv
    tshgyskynltlwdcnsmdpiailkghsfrvlhltlsndgttvvsgagdetlrywklfd
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.