PDB entry 4bh2

View 4bh2 on RCSB PDB site
Description: Crystal Structure of the Haemagglutinin from a Transmissible Mutant H5 Influenza Virus
Class: viral protein
Keywords: viral protein, n-glycosylation, virus receptor, bird flu
Deposited on 2013-03-29, released 2013-04-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.21442
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP31 (2-End)
      • expression tag (0-1)
      • conflict (155)
      • conflict (221)
      • conflict (223)
      • conflict (316)
    Domains in SCOPe 2.02: d4bh2a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bh2A (A:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bh2A (A:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnspq
    

  • Chain 'B':
    No sequence available.