PDB entry 4bgg

View 4bgg on RCSB PDB site
Description: Crystal structure of the ACVR1 kinase in complex with LDN-213844
Class: transferase
Keywords: transferase, inhibitor, bmp signalling
Deposited on 2013-03-26, released 2013-04-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.21685
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (8)
    Domains in SCOPe 2.04: d4bgga_
  • Chain 'B':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (8)
    Domains in SCOPe 2.04: d4bggb_
  • Chain 'C':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (8)
    Domains in SCOPe 2.04: d4bggc_
  • Chain 'D':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (8)
    Domains in SCOPe 2.04: d4bggd_
  • Heterogens: 844, FLC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bggA (A:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bggA (A:)
    tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrym
    apevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfe
    dmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bggB (B:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bggB (B:)
    tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrymape
    vldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfedmr
    kvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bggC (C:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bggC (C:)
    varditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhenil
    gfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhiei
    gkpaiahrdlksknilvkkngqcciadlglavmhsqstnvgnnprvgtkrymapevldet
    iqvdcfdsykrvdiwafglvlwevaredykppfydvvpndpsfedmrkvvcvdqqrpnip
    nrwfsdptltslaklmkecwyqnpsarltalrikktltk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bggD (D:)
    smqrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bggD (D:)
    varditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhenil
    gfiasdmtqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhieifgkpai
    ahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrymapevldetiq
    vdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfedmrkvvcvdq
    qrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki