PDB entry 4bgd

View 4bgd on RCSB PDB site
Description: Crystal structure of Brr2 in complex with the Jab1/MPN domain of Prp8
Class: transcription
Keywords: transcription, spliceosome, RNA helicase, u5 snrnp, retinitis pigmentosa
Deposited on 2013-03-25, released 2013-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.21664
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pre-mRNA-splicing helicase BRR2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32639 (0-1721)
• Chain 'C':
  Compound: Pre-mRNA-splicing factor 8
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33334 (0-247)
  Domains in SCOPe 2.08: d4bgdc_
• Heterogens: ADP, MG, PE5, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bgdC (C:)
  sknewrksaiantllylrlkniyvsaddfveeqnvyvlpknllkkfieisdvkiqvaafi
  ygmsakdhpkvkeiktvvlvpqlghvgsvqisnipdigdlpdteglellgwihtqteelk
  fmaasevathsklfadkkrdcidisifstpgsvslsaynltdegyqwgeenkdimnvlse
  gfeptfsthaqlllsdritgnfiipsgnvwnytfmgtafnqegdynfkygiplefynemh
  rpvhflqf