PDB entry 4bg4

View 4bg4 on RCSB PDB site
Description: Crystal structure of Litopenaeus vannamei arginine kinase in binary complex with arginine
Class: transferase
Keywords: transferase, binary complex,
Deposited on 2013-03-22, released 2013-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1932
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Litopenaeus vannamei [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q004B5 (0-355)
      • conflict (42)
      • conflict (130)
      • conflict (199)
    Domains in SCOPe 2.03: d4bg4a1, d4bg4a2
  • Chain 'B':
    Compound: arginine kinase
    Species: Litopenaeus vannamei [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q004B5 (0-355)
      • conflict (23)
      • conflict (33)
      • conflict (42)
      • conflict (130)
    Domains in SCOPe 2.03: d4bg4b1, d4bg4b2
  • Heterogens: ADP, ARG, NO3, MG, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bg4A (A:)
    madaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpcltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanscrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleev
    agkynlqvrgtrgehteaeggiydisnkrrmgltefqavkemqdgilelikiekem
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bg4B (B:)
    madaaviekleagfkkleaatdcrsllkkyltkdvfdklkdkktslgatlldviqsgven
    ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkqtdkhpnkdfgdvnsfvnvdpegkfv
    istrvrcgrsmqgypfnpcltesqykemeakvsstlsslegelkgtyypltgmskevqqk
    liddhflfkegdrflqaanacrywpagrgiyhndnktflvwvneedhlriismqmggdlg
    qvfrrltsavneiekripfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleev
    agkynlqvrgtrgehteaeggiydisnkrrmgltefqavkemqdgilelikiekem