PDB entry 4bfb

View 4bfb on RCSB PDB site
Description: bace2 xaperone complex
Class: hydrolase/immune system
Keywords: hydrolase-immune system complex, nanobody
Deposited on 2013-03-18, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.20723
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bfba_
  • Chain 'B':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bfbb_
  • Chain 'D':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BFB
    Domains in SCOPe 2.07: d4bfbd1, d4bfbd2
  • Chain 'E':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BFB (0-End)
    Domains in SCOPe 2.07: d4bfbe1, d4bfbe2
  • Heterogens: B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bfbA (A:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bfbA (A:)
    flamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdterss
    tyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngi
    lglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvaggslvlggiepslykg
    diwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavve
    avarasldgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmmg
    aglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisg
    pfstedvasncvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bfbB (B:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bfbB (B:)
    flamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdterss
    tyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngi
    lglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvaggslvlggiepslykg
    diwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavve
    avaraslidgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmm
    gaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseis
    gpfstedvasncvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bfbD (D:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bfbD (D:)
    vqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittya
    dsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bfbE (E:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bfbE (E:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    e