PDB entry 4bf4

View 4bf4 on RCSB PDB site
Description: PikC D50N mutant in complex with the engineered cycloalkane substrate mimic bearing a termianl N,N-dimethylamino group
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, pikromycin biosynthesis
Deposited on 2013-03-14, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.20009
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4a_
  • Chain 'B':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4b_
  • Chain 'C':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4c_
  • Chain 'D':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4d_
  • Chain 'E':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4e_
  • Chain 'F':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4f_
  • Chain 'G':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4g_
  • Chain 'H':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4h_
  • Chain 'I':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4i_
  • Chain 'J':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4j_
  • Chain 'K':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4k_
  • Chain 'L':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4l_
  • Chain 'M':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4m_
  • Chain 'N':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4n_
  • Chain 'O':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4o_
  • Chain 'P':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4bf4p_
  • Heterogens: HEM, SO4, 17Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bf4A (A:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4A (A:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bf4B (B:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4B (B:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bf4C (C:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4C (C:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bf4D (D:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4D (D:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4bf4E (E:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4E (E:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4bf4F (F:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4F (F:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4bf4G (G:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4G (G:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4bf4H (H:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4H (H:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4bf4I (I:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4I (I:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4bf4J (J:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4J (J:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4bf4K (K:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4K (K:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4bf4L (L:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4L (L:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4bf4M (M:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4M (M:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4bf4N (N:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4N (N:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4bf4O (O:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4O (O:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4bf4P (P:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bf4P (P:)
    sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf
    skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
    vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
    maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
    liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
    agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
    llercpdlaldvspgelvwypnpmirglkalpirwr