PDB entry 4bd7

View 4bd7 on RCSB PDB site
Description: Bax domain swapped dimer induced by octylmaltoside
Class: apoptosis
Keywords: apoptosis, programmed cell death
Deposited on 2012-10-05, released 2013-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2042
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (61)
      • engineered mutation (125)
    Domains in SCOPe 2.08: d4bd7a_
  • Chain 'B':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (61)
      • engineered mutation (125)
    Domains in SCOPe 2.08: d4bd7b_
  • Chain 'C':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (61)
      • engineered mutation (125)
    Domains in SCOPe 2.08: d4bd7c_
  • Chain 'D':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (61)
      • engineered mutation (125)
    Domains in SCOPe 2.08: d4bd7d_
  • Heterogens: PR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bd7A (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bd7A (A:)
    tsseqimktgalllqgfiqdragrpqdastkklseslkrigdeldsnmelqrmiaavdtd
    sprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtldflre
    rllgwiqdqggwdgllsyfgtptw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bd7B (B:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bd7B (B:)
    tsseqimktgalllqgfiqdragapelaldpvpqdastkklseslkrigdeldsnmelqr
    miaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimg
    wtldflrerllgwiqdqggwdgllsyfgtptw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bd7C (C:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bd7C (C:)
    sseqimktgalllqgfiqdrastkklseslkrigdeldsnmelqrmiasprevffrvaad
    mfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtldflrerllgwiqdqggw
    dgllsyfgtptw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bd7D (D:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bd7D (D:)
    seqimktgalllqgfiqdragstkklseslkrigdeldsnmelqrmiaaprevffrvaad
    mfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtldflrerllgwiqdqggw
    dgllsyfgtptw