PDB entry 4bcx

View 4bcx on RCSB PDB site
Description: gamma 2 adaptin EAR domain crystal structure
Class: protein transport
Keywords: protein transport, gae, gamma adaptin
Deposited on 2012-10-03, released 2013-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ap-1 complex subunit gamma-like 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bcxa_
  • Heterogens: IMD, PDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4bcxA (A:)
ggsapipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficqaavpksl
qlqlqapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeifevnnlpv
eswq

    Sequence, based on observed residues (ATOM records): (download) 
    >4bcxA (A:)
pipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficqaavpkslqlql
qapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeifevnnlpveswq