PDB entry 4bcs

View 4bcs on RCSB PDB site
Description: Crystal structure of an avidin mutant
Class: biotin-binding protein
Keywords: biotin-binding protein, ligand binding
Deposited on 2012-10-03, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19105
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimeric avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BCS (Start-124)
    Domains in SCOPe 2.07: d4bcsa_
  • Chain 'B':
    Compound: chimeric avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BCS
    Domains in SCOPe 2.07: d4bcsb_
  • Heterogens: ACT, PEG, BTN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bcsA (A:)
    arkcsltgkwtddlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndisddwiatrvginiftr
    qrtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcsA (A:)
    kcsltgkwtddlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndisddwiatrvginiftrqr
    tqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bcsB (B:)
    arkcsltgkwtddlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndisddwiatrvginiftr
    qrtqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcsB (B:)
    kcsltgkwtddlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndisddwiatrvginiftrq