PDB entry 4bcm

View 4bcm on RCSB PDB site
Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Class: transferase/cell cycle
Keywords: transferase-cell cycle complex, cdk-cyclin complex, structure-based drug design
Deposited on 2012-10-02, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.1981
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4bcma_
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4bcmb1, d4bcmb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.05: d4bcmc_
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20248
      • conflict (160)
    Domains in SCOPe 2.05: d4bcmd1, d4bcmd2
  • Heterogens: T7Z, SGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bcmA (A:)
    pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcmA (A:)
    pgsmenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnh
    pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
    hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
    stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
    pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bcmB (B:)
    svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsir
    ekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcmB (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bcmC (C:)
    pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
    lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
    chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
    kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
    psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcmC (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bcmD (D:)
    svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckvellamflgelslidadpylky
    lpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsir
    ekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bcmD (D:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhllamflgelslidadpylkylpsviagaafhlaw
    peslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe