PDB entry 4bce

View 4bce on RCSB PDB site
Description: crystal structure of Ttb-gly N282T mutant
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase family 1, transglycosidase
Deposited on 2012-10-02, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15725
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53W75
      • engineered mutation (281)
      • engineered mutation (319)
    Domains in SCOPe 2.06: d4bcea_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53W75
      • engineered mutation (281)
      • engineered mutation (319)
    Domains in SCOPe 2.06: d4bceb_
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53W75
      • engineered mutation (281)
      • engineered mutation (319)
    Domains in SCOPe 2.06: d4bcec_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bceA (A:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsal
    wyreriaraqthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bceA (A:)
    ekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedial
    mqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpla
    leerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnl
    eaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffldp
    ilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvrylppeg
    patamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayleah
    veaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyrer
    iara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bceB (B:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsal
    wyreriaraqthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bceB (B:)
    naekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedi
    almqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlp
    laleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglr
    nleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffl
    dpilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvrylpp
    egpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayle
    ahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyr
    eriar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bceC (C:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsal
    wyreriaraqthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bceC (C:)
    ekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedial
    mqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpla
    leerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnl
    eaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffldp
    ilgkgypespfrdpppvpilsrdlelvarpldflgvtyyapvrvapgtgtlpvrylppeg
    patamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayleah
    veaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyrer
    iara