PDB entry 4bc6

View 4bc6 on RCSB PDB site
Description: Crystal structure of human serine threonine kinase-10 bound to novel Bosutinib Isoform 1, previously thought to be Bosutinib
Class: transferase
Keywords: transferase
Deposited on 2012-10-01, released 2012-10-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2136
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4bc6a_
  • Heterogens: XZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bc6A (A:)
    ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
    ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
    alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmapev
    vmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskw
    svefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bc6A (A:)
    ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
    ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
    alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqpywmapevvmcetmkd
    tpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdfl
    kialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevme