PDB entry 4bbg

View 4bbg on RCSB PDB site
Description: Crystal structure of human kinesin Eg5 in complex with 3-(((2-Aminoethyl)sulfanyl)(3-ethylphenyl) phenylmethyl)phenol
Class: cell cycle
Keywords: cell cycle, mitosis, inhibitor
Deposited on 2012-09-22, released 2013-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.18491
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4bbga_
  • Heterogens: ADP, MG, CL, V02, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bbgA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bbgA (A:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
    kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
    prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
    kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
    kigklnlvdlagsenininqslltlgrvitalvertphvpyreskltrilqdslggrtrt
    siiatispaslnleetlstleyahraknilnkpevn