PDB entry 4bag

View 4bag on RCSB PDB site
Description: Feruloyl Esterase Domain of XYNY from Clostridium thermocellum after exposure to 266nm UV laser
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-09-14, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1682
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51584 (Start-288)
      • expression tag (289-296)
      • conflict (228-229)
    Domains in SCOPe 2.05: d4baga_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51584 (Start-288)
      • expression tag (289-296)
      • conflict (228-229)
    Domains in SCOPe 2.05: d4bagb_
  • Heterogens: CD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bagA (A:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bagA (A:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bagB (B:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bagB (B:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh