PDB entry 4ba5

View 4ba5 on RCSB PDB site
Description: Crystal structure of omega-transaminase from Chromobacterium violaceum
Class: transferase
Keywords: transferase
Deposited on 2012-09-11, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.1747
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Chromobacterium violaceum [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ba5a_
  • Chain 'B':
    Compound: aminotransferase
    Species: Chromobacterium violaceum [TaxId:536]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ba5b_
  • Heterogens: PXG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ba5A (A:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ba5A (A:)
    arvmtrgegvylwdsegnkiidgmaglwcvnvgygrkdfaeaarrqmeelpfyntffktt
    hpavvelssllaevtpagfdrvfytnsgsesvdtmirmvrrywdvqgkpekktligrwng
    yhgstiggaslggmkymheqgdlpipgmahieqpwwykhgkdmtpdefgvvaarwleeki
    leigadkvaafvgepiqgaggvivppatywpeiericrkydvllvadevicgfgrtgewf
    ghqhfgfqpdlftaakglssgylpigavfvgkrvaegliaggdfnhgftysghpvcaava
    hanvaalrdegivqrvkddigpymqkrwretfsrfehvddvrgvgmvqaftlvknkakre
    lfpdfgeigtlcrdiffrnnlimracgdhivsapplvmtraevdemlavaercleefeqt
    lkargla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ba5B (B:)
    mqkqrttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglw
    cvnvgygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsg
    sesvdtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgm
    ahieqpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppat
    ywpeiericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigav
    fvgkrvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrw
    retfsrfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgd
    hivsapplvmtraevdemlavaercleefeqtlkargla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ba5B (B:)
    arvmtrgegvylwdsegnkiidgmaglwcvnvgygrkdfaeaarrqmeelpfyntffktt
    hpavvelssllaevtpagfdrvfytnsgsesvdtmirmvrrywdvqgkpekktligrwng
    yhgstiggaslggmkymheqgdlpipgmahieqpwwykhgkdmtpdefgvvaarwleeki
    leigadkvaafvgepiqgaggvivppatywpeiericrkydvllvadevicgfgrtgewf
    ghqhfgfqpdlftaakglssgylpigavfvgkrvaegliaggdfnhgftysghpvcaava
    hanvaalrdegivqrvkddigpymqkrwretfsrfehvddvrgvgmvqaftlvknkakre
    lfpdfgeigtlcrdiffrnnlimracgdhivsapplvmtraevdemlavaercleefeqt
    lkargla