PDB entry 4ba1

View 4ba1 on RCSB PDB site
Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
Class: hydrolase
Keywords: hydrolase, RNA degradation,
Deposited on 2012-09-10, released 2012-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18576
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UXC0 (2-276)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4ba1a1, d4ba1a2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UXC2
      • engineered mutation (183)
    Domains in SCOPe 2.05: d4ba1b1, d4ba1b2
  • Chain 'I':
    Compound: Probable exosome complex RNA-binding protein 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ba1i1, d4ba1i2, d4ba1i3
  • Heterogens: 1PE, PEG, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ba1A (A:)
    ghmsstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvkl
    gttmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrsl
    rdskaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsn
    gisvnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgi
    qksgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ba1A (A:)
    ghmsstpnniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhisvn
    knevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgk
    gsmslqdidqaentarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ba1B (B:)
    ghmremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaav
    ygpkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlve
    lfprtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildln
    eteamwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealks
    kyvefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ba1B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlneteamwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ba1I (I:)
    ghmnmsqsqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqf
    eviplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrr
    yldvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetl
    tsksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklger
    nassgetktns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ba1I (I:)
    sqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
    sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgerryldvgdyvi
    arienfdrsidpvlsvkgkdlgrvsngividimpvkvprvignksmyetltskcsifvan
    ngriwasrfseeilieairkiene