PDB entry 4b9r

View 4b9r on RCSB PDB site
Description: Crystal structure of the Major Birch Pollen Allergen Bet v 1.0101 (isoform a) nitrated in vitro with tetranitromethan.
Class: allergen
Keywords: allergen, nitration, nitrotyrosine
Deposited on 2012-09-06, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.16824
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4b9ra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b9rA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn