PDB entry 4b9p

View 4b9p on RCSB PDB site
Description: Biomass sensoring module from putative Rsgi2 protein of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Class: carbohydrate-binding protein
Keywords: carbohydrate-binding protein, cellulose, rsgi-like proteins, biomass sensing system
Deposited on 2012-09-06, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.1254
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type 3a cellulose-binding domain protein
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9pa_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b9pA (A:)
    tdlltkielqaynhirtsetkelqpriklintgntpitlsevkiryyytkdqvineiytc
    dwsnitsskitgtvvqmsnpkpnadsyveigftnsagvlnpgeyveiisrignsyalsla
    tppysewnymydqnsdysfnnsssdfvvwdkitvyisgtlywgiep