PDB entry 4b9f

View 4b9f on RCSB PDB site
Description: High resolution structure for family 3a carbohydrate binding module from the cipA scaffolding of clostridium thermocellum
Class: sugar binding protein
Keywords: sugar binding protein, cellulosome
Deposited on 2012-09-04, released 2012-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.1517
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9fa_
  • Chain 'B':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9fb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4b9fA (A:)
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4b9fB (B:)
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwg