PDB entry 4b9c

View 4b9c on RCSB PDB site
Description: Biomass sensoring modules from putative Rsgi-like proteins of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Class: carbohydrate-binding protein
Keywords: carbohydrate-binding protein, biomass sensoring system
Deposited on 2012-09-04, released 2013-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.1704
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type 3a cellulose-binding domain protein
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DBH1 (4-149)
      • expression tag (0-3)
    Domains in SCOPe 2.05: d4b9ca_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b9cA (A:)
    gshmglkiqyysrkphdsagidfsfrmfntgneaidlkdvkvryyfkedvsidemnwavy
    fyslgsekdvqcrfyelpgkkeankyleitfksgtlspndvmyitgefykndwtkfeqrd
    dysynpadsysdwkrmtayisnklvwgiep