PDB entry 4b9b

View 4b9b on RCSB PDB site
Description: The structure of the omega aminotransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: transferase
Deposited on 2012-09-03, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.17672
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9ba_
  • Chain 'B':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bb_
  • Chain 'C':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bc_
  • Chain 'D':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bd_
  • Chain 'E':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9be_
  • Chain 'F':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bf_
  • Chain 'G':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bg_
  • Chain 'H':
    Compound: beta-alanine-pyruvate transaminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b9bh_
  • Heterogens: PLP, GOL, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b9bA (A:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bA (A:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b9bB (B:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bB (B:)
    elnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkeiq
    eavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmara
    ywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaft
    rgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqhn
    illifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmnq
    alpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgakn
    vidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpeel
    drlfdavgealngia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4b9bC (C:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bC (C:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b9bD (D:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bD (D:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4b9bE (E:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bE (E:)
    elnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkeiq
    eavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmara
    ywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaft
    rgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqhn
    illifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmnq
    alpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgakn
    vidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpeel
    drlfdavgealngia
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4b9bF (F:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bF (F:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4b9bG (G:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bG (G:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4b9bH (H:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b9bH (H:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia