PDB entry 4b95

View 4b95 on RCSB PDB site
Description: pVHL-EloB-EloC complex_(2S,4R)-1-(2-chlorophenyl)carbonyl-N-[(4-chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
Class: transcription
Keywords: transcription, hypoxia inducible factor, hif-1alpha inhibitor
Deposited on 2012-08-31, released 2012-10-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
• Chain 'B':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (2-96)
    • expression tag (1)
• Chain 'C':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Chain 'D':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
• Chain 'E':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (2-96)
    • expression tag (1)
• Chain 'F':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Chain 'G':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
• Chain 'H':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (2-96)
    • expression tag (1)
  Domains in SCOPe 2.02: d4b95h_
• Chain 'I':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
  Domains in SCOPe 2.02: d4b95i_
• Chain 'J':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
  Domains in SCOPe 2.02: d4b95j_
• Chain 'K':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (2-96)
    • expression tag (0-1)
• Chain 'L':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Heterogens: ACT, UCK, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >4b95H (H:)
  mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
  yftykvrytnssteipefpiapeialellmaanfldc
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4b95H (H:)
  myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
  ssteipefpiapeialellmaanfldc
  

  
  
• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >4b95I (I:)
  gsmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihs
  yrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvk
  penyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4b95I (I:)
  vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
  agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
  rslyedledhpnvqkdlerltqer
  

  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >4b95J (J:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4b95J (J:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafradtfealciepfssppelpdvm
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.