PDB entry 4b8z

View 4b8z on RCSB PDB site
Description: Crystal structure of human GDP-L-fucose synthase with bound NADP and GDP, rhombohedral crystal form
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-08-31, released 2013-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.2347
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b8za_
  • Chain 'B':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13630 (7-319)
      • expression tag (0-6)
    Domains in SCOPe 2.05: d4b8zb_
  • Chain 'C':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b8zc_
  • Chain 'D':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b8zd_
  • Heterogens: NAP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b8zA (A:)
    enlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8zA (A:)
    mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
    hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
    etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
    lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
    devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
    tcawftdn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b8zB (B:)
    enlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4b8zC (C:)
    enlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8zC (C:)
    mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
    hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
    etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
    lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
    devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
    tcawftdnyeqar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b8zD (D:)
    enlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8zD (D:)
    mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
    hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
    etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
    lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
    devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
    tcawftdnyeqar