PDB entry 4b8w

View 4b8w on RCSB PDB site
Description: Crystal structure of human GDP-L-fucose synthase with bound NADP and GDP, tetragonal crystal form
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-08-31, released 2012-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.2035
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13630 (5-318)
      • expression tag (0-4)
    Domains in SCOPe 2.05: d4b8wa_
  • Chain 'B':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13630 (5-End)
      • expression tag (2-4)
    Domains in SCOPe 2.05: d4b8wb_
  • Heterogens: NAP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b8wA (A:)
    nlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekv
    qpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdk
    ttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfn
    iedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepii
    lsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpf
    kqavketcawftdnyeqar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b8wB (B:)
    nlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekv
    qpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdk
    ttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfn
    iedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepii
    lsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpf
    kqavketcawftdnyeqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8wB (B:)
    yfqsmrilvtggsglvgkaiqkvvapgedwvfvsskdadltdtaqtralfekvqpthvih
    laamvnldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypidetmihngpph
    nsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghvlpglihkvhl
    akssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgeedevsikeaae
    avveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavketcawftdnye