PDB entry 4b8l

View 4b8l on RCSB PDB site
Description: Aurora B kinase P353G mutant
Class: cell cycle
Keywords: cell cycle, cancer
Deposited on 2012-08-28, released 2013-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23963
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4b8la_
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: A0P

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b8lA (A:)
    atalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegveh
    qlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatf
    meeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldyl
    ppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgs
    kdliskllryhppqrlplkgvmehpwvkansrrvlpgvyqstqskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b8lA (A:)
    kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
    hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
    cherkvihrdikpenllmgykgelkiadftldylppemiegkthdekvdlwcagvlcyef
    lvgmppfdspshtethrrivnvdlkfppflsdgskdliskllryhppqrlplkgvmehpw
    vkansrrvl
    

  • Chain 'D':
    No sequence available.