PDB entry 4b7s

View 4b7s on RCSB PDB site
Description: PikC D50N mutant bound to the 10-DML analog with the 3-(N,N- dimethylamino)propanoate anchoring group
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, pikromycin biosynthesis, inhibitor
Deposited on 2012-08-21, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.16887
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4b7sa_
  • Chain 'B':
    Compound: cytochrome p450 hydroxylase pikc
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87605
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4b7sb_
  • Heterogens: HEM, SO4, QLE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b7sA (A:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7sA (A:)
    asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
    fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
    lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
    amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
    nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
    pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
    allercpdlaldvspgelvwypnpmirglkalpirwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b7sB (B:)
    mgsshhhhhhssglvprgshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7sB (B:)
    vldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfskd
    wrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvda
    mlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamae
    msgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnlia
    ngmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagd
    tvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavralle
    rcpdlaldvspgelvwypnpmirglkalpirwr