PDB entry 4b7j

View 4b7j on RCSB PDB site
Description: H1N1 2009 Pandemic Influenza Virus: Resistance of the I223R Neuraminidase Mutant Explained by Kinetic and Structural Analysis
Class: hydrolase
Keywords: hydrolase, neuraminidase inhibitor, nai, nais, oseltamivir, zanamivir, antiviral resistance, immunocompromised, h275y
Deposited on 2012-08-20, released 2012-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.1914
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b7ja_
  • Heterogens: NAG, CA, G39, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b7jA (A:)
    mnpnqkiitigsvcmtigmanlilqigniisiwishsiqlgnqnqietcnqsvityennt
    wvnqtyvnisntnfaagqsvvsvklagnsslcpvsgwaiyskdnsirigskgdvfvirep
    fiscsplecrtffltqgallndkhsngtikdrspyrtlmscpigevpspynsrfesvaws
    asachdginwltigisgpdngavavlkyngiitdtikswrnnrlrtqesecacvngscft
    vmtdgpsdgqasykifriekgkivksvemnapnyhyeecscypdsseitcvcrdnwhgsn
    rpwvsfnqnleyqigyicsgifgdnprpndktgscgpvssngangvkgfsfkygngvwig
    rtksissrngfemiwdpngwtgtdndfsikqdivginewsgysgsfvqhpeltgldcirp
    cfwvelirgrpkentiwtsgssisfcgvnsdtvgwswpdgaelpftidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b7jA (A:)
    vklagnsslcpvsgwaiyskdnsirigskgdvfvirepfiscsplecrtffltqgallnd
    khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga
    vavlkyngiitdtikswrnnrlrtqesecacvngscftvmtdgpsdgqasykifriekgk
    ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif
    gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg
    tdndfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss
    isfcgvnsdtvgwswpdgaelpftidk