PDB entry 4b6m

View 4b6m on RCSB PDB site
Description: Trypansoma brucei tubulin binding cofactor B CAP-Gly domain
Class: structural protein
Keywords: structural protein
Deposited on 2012-08-14, released 2012-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin-specific chaperone, putative
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0A053 (Start-83)
      • see remark 999 (82)
    Domains in SCOPe 2.08: d4b6ma_
  • Chain 'B':
    Compound: tubulin-specific chaperone, putative
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0A053
      • see remark 999 (82)
    Domains in SCOPe 2.08: d4b6mb_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b6mA (A:)
    ghmetihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfq
    cqpnyggflrpdqvevgdfppevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b6mA (A:)
    tihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfqcqpn
    yggflrpdqvevgdfppevf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b6mB (B:)
    ghmetihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfq
    cqpnyggflrpdqvevgdfppevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b6mB (B:)
    tihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfqcqpn
    yggflrpdqvevgdfppev