PDB entry 4b50

View 4b50 on RCSB PDB site
Description: Crystal structure of the HIV-1 gp41 MPER-specific llama VHH 2H10
Class: immune system
Keywords: immune system, neutralizing antibody
Deposited on 2012-08-02, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.1468
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2h10 llama vhh
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B50 (0-121)
    Domains in SCOPe 2.04: d4b50a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b50A (A:)
    evqlvesggglvqpggslrlscaasgsissvdvmswyrqapgkqrelvafitdrgrtnyk
    vsvkgrftisrdnsknmvylqmnslkpedtadylcraesrtswsspspldvwgrgtqvtv
    ss