PDB entry 4b4v

View 4b4v on RCSB PDB site
Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor and inhibitor LY354899
Class: oxidoreductase
Keywords: oxidoreductase, inhibitor
Deposited on 2012-08-01, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: ACINETOBACTER BAUMANNII ATCC 19606 [TaxId:575584]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b4va1, d4b4va2
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: ACINETOBACTER BAUMANNII ATCC 19606 [TaxId:575584]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b4vb1, d4b4vb2
  • Heterogens: NAP, GOL, CL, L34, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b4vA (A:)
    mgsshhhhhhssgenlyfqghmalvldgralakqieenllvrvealkaktgrtpilatil
    vgddgasatyvrmkgnacrrvgmdslkielpqettteqllaeieklnanpdvhgillqhp
    vpaqideracfdaislakdvdgvtclgfgrmamgeaaygsatpagimtilkennieiagk
    havvvgrsailgkpmammllqanatvtichsrtqnlpelvkqadiivgavgkaeliqkdw
    ikqgavvvdagfhprdgggvgdiqlqgieeiasaytpvpggvgpmtittlirqtveaaek
    alg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b4vA (A:)
    malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
    gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
    gvtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllq
    anatvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvg
    diqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b4vB (B:)
    mgsshhhhhhssgenlyfqghmalvldgralakqieenllvrvealkaktgrtpilatil
    vgddgasatyvrmkgnacrrvgmdslkielpqettteqllaeieklnanpdvhgillqhp
    vpaqideracfdaislakdvdgvtclgfgrmamgeaaygsatpagimtilkennieiagk
    havvvgrsailgkpmammllqanatvtichsrtqnlpelvkqadiivgavgkaeliqkdw
    ikqgavvvdagfhprdgggvgdiqlqgieeiasaytpvpggvgpmtittlirqtveaaek
    alg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b4vB (B:)
    malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
    gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
    gvtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllq
    anatvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvg
    diqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg