PDB entry 4b4u

View 4b4u on RCSB PDB site
Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-08-01, released 2012-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.12319
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: ACINETOBACTER BAUMANNII ATCC 19606 [TaxId:575584]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4b4ua1, d4b4ua2
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: ACINETOBACTER BAUMANNII ATCC 19606 [TaxId:575584]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0CBC8 (21-302)
      • expression tag (17-20)
    Domains in SCOPe 2.06: d4b4ub1, d4b4ub2, d4b4ub3
  • Heterogens: NAP, CL, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b4uA (A:)
    mgsshhhhhhssgenlyfqghmalvldgralakqieenllvrvealkaktgrtpilatil
    vgddgasatyvrmkgnacrrvgmdslkielpqettteqllaeieklnanpdvhgillqhp
    vpaqideracfdaislakdvdgvtclgfgrmamgeaaygsatpagimtilkennieiagk
    havvvgrsailgkpmammllqanatvtichsrtqnlpelvkqadiivgavgkaeliqkdw
    ikqgavvvdagfhprdgggvgdiqlqgieeiasaytpvpggvgpmtittlirqtveaaek
    alg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b4uA (A:)
    malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
    gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
    gvtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllq
    anatvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvg
    diqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b4uB (B:)
    mgsshhhhhhssgenlyfqghmalvldgralakqieenllvrvealkaktgrtpilatil
    vgddgasatyvrmkgnacrrvgmdslkielpqettteqllaeieklnanpdvhgillqhp
    vpaqideracfdaislakdvdgvtclgfgrmamgeaaygsatpagimtilkennieiagk
    havvvgrsailgkpmammllqanatvtichsrtqnlpelvkqadiivgavgkaeliqkdw
    ikqgavvvdagfhprdgggvgdiqlqgieeiasaytpvpggvgpmtittlirqtveaaek
    alg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b4uB (B:)
    fqghmalvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgna
    crrvgmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaisla
    kdvdgvtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmam
    mllqanatvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdg
    ggvgdiqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg