PDB entry 4b4n

View 4b4n on RCSB PDB site
Description: CPSF6 defines a conserved capsid interface that modulates HIV-1 replication
Class: viral protein/RNA binding protein
Keywords: viral protein-RNA binding protein complex, hiv-1, cyclophilin
Deposited on 2012-07-31, released 2012-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4b4na_
  • Chain 'B':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4b4nA (A:)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

    Sequence, based on observed residues (ATOM records): (download) 
    >4b4nA (A:)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

  • Chain 'B':
    No sequence available.