PDB entry 4b4l

View 4b4l on RCSB PDB site
Description: crystal structure of an ard dap-kinase 1 mutant
Class: transferase
Keywords: transferase, autoinhibition
Deposited on 2012-07-31, released 2013-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19336
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355
      • engineered mutation (303)
    Domains in SCOPe 2.04: d4b4la_
  • Heterogens: 1PE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b4lA (A:)
    gamtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsr
    edierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeate
    flkqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknif
    gtpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefed
    eyfsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkk
    faaakkwkqsvrlislcqrlsrsflsrsnmsvarsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b4lA (A:)
    rqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsrediere
    vsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqil
    ngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpefv
    apeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsnt
    salakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaaak