PDB entry 4b41

View 4b41 on RCSB PDB site
Description: Crystal structure of an amyloid-beta binding single chain antibody G7
Class: immune system
Keywords: immune system, alzheimer's disease
Deposited on 2012-07-27, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.1374
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody g7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B41 (Start-117)
    Domains in SCOPe 2.07: d4b41a_
  • Chain 'B':
    Compound: antibody g7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4B41 (Start-117)
    Domains in SCOPe 2.07: d4b41b_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b41A (A:)
    evqlvesggglvqpggslrlscaasrsiisnnamgwyrqapgkqrelvarissggrttya
    dsvkgrftisrdnakttvylqmnslkpedtavyycnaaslvrgpldhwgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b41A (A:)
    vqlvesggglvqpggslrlscaasrsiisnnamgwyrqapgkqrelvarissggrttyad
    svkgrftisrdnakttvylqmnslkpedtavyycnaaslvrgpldhwgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b41B (B:)
    evqlvesggglvqpggslrlscaasrsiisnnamgwyrqapgkqrelvarissggrttya
    dsvkgrftisrdnakttvylqmnslkpedtavyycnaaslvrgpldhwgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b41B (B:)
    vqlvesggglvqpggslrlscaasrsiisnnamgwyrqapgkqrelvarissggrttyad
    svkgrftisrdnakttvylqmnslkpedtavyycnaaslvrgpldhwgqgtqvtvss